PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_012574097.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 258aa    MW: 29594.1 Da    PI: 6.7249
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_012574097.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260126.31.4e-39221221101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rrkCa+dC+lapyfp++++++f n+hklFG+sn+ k++k l++  +++am+++++++++ra+dPv G+++ i++lq q+e  kael+
  XP_012574097.1  22 ACAACKYQRRKCAPDCILAPYFPHDKQRQFLNAHKLFGVSNINKIIKYLDPPLKDQAMRTIIFQSDMRANDPVGGCYKYIQDLQAQIEYCKAELD 116
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                     l++++l
  XP_012574097.1 117 LVHQQL 122
                     ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.54721122IPR004883Lateral organ boundaries, LOB
PfamPF031957.3E-3722119IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MNNNNITCIT RNNSNNNNTT QACAACKYQR RKCAPDCILA PYFPHDKQRQ FLNAHKLFGV  60
SNINKIIKYL DPPLKDQAMR TIIFQSDMRA NDPVGGCYKY IQDLQAQIEY CKAELDLVHQ  120
QLALFRAQAQ QQQQVYGGDQ VIMNGDSLLG FYNQGSIVSA NNPHYQYNIQ QMVPQQEQEQ  180
YLMMHESNSS IHNSPLQQHI NSWAMQSSIS LSSLSLHGQS SNASDEYDHK QILDIPCDER  240
NELGFDSREI LHHSLWPK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1409151e-108AC140915.6 Medicago truncatula chromosome 8 clone mth2-10l24 map 9.500cM, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012574097.10.0PREDICTED: LOB domain-containing protein 22 isoform X2
TrEMBLG7LHF81e-122G7LHF8_MEDTR; LOB domain protein
STRINGGLYMA07G01170.23e-95(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-51LOB domain-containing protein 22